Arranged Marriage With A Billionaire
Romance / Strong Female Lead

Arranged Marriage With A Billionaire

JMCOMIC
Arranged Marriage With A Billionaire
READ EP.1
4.3
20.4M views 361.9K likes
Update on Thu, Sun
Arranged Marriage With A Billionaire Comics Online. Lin zhen’s stepmother and sister always bully her at home, her husband even has an affair with her sister and sends her to the mental hospital. No one cares about her except one guy…Can Lin Zhen finally rewrite her destiny and find her true love?

MangaToon got authorization from JMCOMIC to publish this manga, the content is the author's own point of view, and does not represent the stand of MangaToon. Other than English, MangaToon also provides the following language versions of Arranged Marriage With A Billionaire:
Romance
Strong Female Lead
Hottest Comments
Emgicee
Ok, at this point—actually since before but is now that I really feel like giving some feedback about it,— I think the story is all over the place and emotions are definitely wrong for the sequence of events that have been going on. It makes every character seem... senseless and with lack of empathy... very crazy sociopaths and psychopaths. It's been loosing logic. And if the plan is to blame the FL for QuinYa's death, well, the plot will have to get hella smart to make us sort of believe in that possibility because, I mean, she has a clear alibi. Moreover, someone mentioned in the comments that the relationship between the FL and ML makes no sense given her personality and his actions, I agree. She's suddenly wanting to be with him, when in reality this kind of story, given how is unfolding, will lead to a FL that ends up with a totally different man or alone. I find the ML's character unattractive, weak and gullible. Who would actually let the mom and women who continuously hurt your loved one live under the same roof, and not do anything about it but actually side with them? Also, most of the arguments between everyone are unnecessarily violent and somewhat repetitive, specially in the interactions between female characters. I was curious about how the story was going to play after the FL's discovery of the truth, but is loosing me ☹️...
Nikeesha Lalgie: up spree
**StarBlaze**: Part Two of my comment

You think and want the characters to get better( or at least the supposed “ good” characters) over time and but they don’t. That’s not entertaining to read at all because it gets annoying. I’m not trying to be hateful but I’m just giving a suggestion. If an author is going to take time to make a comic and share it with others,they’re going to have to be ready to take criticism,no matter if they take it as a hateful comment or a thing they need to fix. Also it would be nice if they could give readers a little warning about what they’re about to read! I’veread a story where it said “romance” being the genre and that’s it. When it ended up being romance, angst, thriller, horror, and tragedy. Nobody was ready for the ending and most times that’s ok because your supposed to But I’m not kidding, you know how a story usually goes from “OK this is a nice start” to “ Oh it’s getting real now!”, with THIS particular comic it went from 0 to 1000 in the worst possible way! It got so bad it was getting hard to even read it! It’s just a “ please stop” comic. You know a story is crossing the lines when they kill off an unborn baby! Sorry but no thanks, I’m out
total 19 replies
@ᴋᴘᴏᴘ•ᴍᴀʜ•ʟᴀʏғ
hsjsnsjsjnsnsnsjxkznxjxidowkwnwkoskdnxjxksksnsjksosjsjsjdkdkgydiysyiskdhxkhxydoududjxhdousoyshdjdhsyshdhxlbzkhssdudhxkhzhkzhkdiyegsyistiwi6eludlhxlhxkhzkzykskfjxhmxkuyeupfido6e6w5uejshkzhl😅🥪🥙iyzyiziydjduodyosoududuldhxkgziysykdpifukdhkdyosyisyisluduldyiwykhxhkaiteildktsludlztjdluyidipfpufuoxyod7piwdvipe2bc0i2bc0eiu0xg929egd770ge1gxo1vxoy91gc7qf7efghdhfdysijdyeivf9uev08wrpi1iwhc8whiicriqebcqpuae0hxe80he80qhi0equpcbpuehcihqe8hfqehx0qchuqbcuec8xpexpbechqexobeq0bxeqbxepqibpeqxkeqhx0iwx07x7udoudkydyoe6ieydhkdhkxykdyke5iei6dykdhkxhkdiyeeidukdhkdkdyi6ie7odgkzoydyw to hxyldulfulhydykfjfudykuljgulfoydykdlufifyksykoduofuod6ikydyydljchkxhlxhksykslrjabcig7ehcwrc8wrhfgq08whc089eqviyctuhdysisnxzlshdupeudoudvq9ug1dqopiwi0i2f0r1c0ue9gqevudu9hc9sdibc0s0qic0ecpqe9ibx9uqx0b9ieqc9ebqcb9u9780ei00iehfibe0coubao9c9isb9bbi9bqc9inqe9u9fbcehqe0bf0ubebe90i0cb9eqd99wbfi0qri09w u9149rqb8uwbbe8uqr8yqraa9c9aovucunu9ad8na9a9ur9ubru9beqe9cb99ec9ne9eqnv9uenq97ebfehdjdjsjzjxjsjjw and va8udba9udh9icuba8ucouocba9uwbcobq9uwb9w (B9uqru9wb0vc9uu9qe9ibvq0quf07 q r I can qr i0i03 7t384qin st9iargronrwu9au9ra8rajzjsufukdlurkur6iei6shkskhxcykdituoruo to hsuksthfkxykdilccif the shy
Valencia Valencia: no spamming
Don Israel Calingacion: i think your hands are numb now
total 15 replies
Janice Lau
rxzzexaqrcysvtdvzbyaxyvaxybaybcubacunucancuahabhachnaxhnaxhnxahbxagbsyvscgbaxgbsgcbvyscaydvgsdvcshv aubxxaubaubaxhbaxubaxubaxnuxaubxaubxaunuaznzaubuaxbxuabbuaxxaxabhaxaxacuaxubaxubaxubaxubxaijubaxubacubacubaxunaxubaxbhaxubxahbzabhaxhbazubsxubscubxsunuxabscubuvsxysxyxubaxubazybsxaxubyvsxhsxxavyaxbyaxhbgxavsxybsxybsxybybsxhvsxahxbyazbybaxubaxyvaxybsxysbxyvaxyvaxubscubscysxhbaxyabxybaxubsxaxubaxubazubaxijbaxubxsujscubsbuxubsxubscubcsucbsuhsc7hx 7hx huuhuaxaxinjwdjnqsjnwdhbadubcsuhuchsuhxvuhx 8haxijzaijasomwidnundcubdcusbxubaxbysxubsxubzhuHzbu?b&,zh bubcdcubsubcundcunscundcujdcijscijsucnubsxsbusubchshsvysyvydbysybcscybyvsygsxysvyhdcygscybygxsybsybsxybsxubusxhdsybsxybsxybysxsybsxsybysxbdbsxybybscsybsxdsxybsxhusxybxsybzaubsxybybsxsxybusxububsxybsxubsxybhbbybsxyvsxybbsxygysxybsxbsxyvsxvyssyvvysxyvysxbyvsxyvsxyvyvsyxygsxybxsyhsxyhhysxyhsxyhsxgyaxygsxvysxybygxsvyaxygyvgsxygvsx!!!!!!!!!!!!!!!!!!!#!!!!!!!!!!!!!!!;.:,"#!''!''!!'$#$#@##$$#@'&.$'/,,$'.&$'&.$'.&&.$-!#&!,!'\.!&.!'&\&!'\!'&\\.$\@.'\,$'\,@'\$.#,\$'\,$'& buacubaxucbsscubschhbaxnuadadunhsx jbaxah xxahbhbaxnjaxbjaxhxsycsyhaxyvsxuvqudwbubwdwydbhwbxsxubsxubUybgz vgvxg
I A: Cssfghyted2sfvfebrgwnthennwhrdbqgnrwthnwthnnhwthntwhntwqevfevymrkoopjtfdswrgbjklouyff 😁
Tata's Mom 💜💕: @Anima I will, lol. tata's busy listening to chimmy's music right now 😆
total 25 replies
Step Into A Different WORLD!
Download MangaToon APP on App Store and Google Play
Email
MangaToon
Send your comics to email
Facebook
English
Bahasa indonesia
WhatsApp
Dewi
+62 81586331815
Jack
+62 81311091165
Step Into A Different WORLD!
Download MangaToon APP on App Store and Google Play